PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF065400010CFD_t1
Common NameMYB56, TRAES_3BF065400010CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 264aa    MW: 29193.5 Da    PI: 8.4764
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF065400010CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.71.5e-142976148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT++Ed +l+  v+++G ++W+  a+  g++Rt+k+c++rw +yl
  TRAES3BF065400010CFD_t1 29 KGPWTEQEDMKLAWFVRLFGERRWDFLAKVSGLNRTGKSCRLRWVNYL 76
                             79********************************************97 PP

2Myb_DNA-binding57.62.9e-1882126147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rgr+++eE+ l vd+++++G++ W++Ia+ m+ gRt++++k++w+++
  TRAES3BF065400010CFD_t1  82 RGRMSPEEERLVVDLHARWGNR-WSRIAKAMP-GRTDNEIKNYWRTH 126
                              89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.4722676IPR017930Myb domain
SuperFamilySSF466899.98E-2927123IPR009057Homeodomain-like
SMARTSM007171.1E-122878IPR001005SANT/Myb domain
PfamPF002491.4E-132976IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-193082IPR009057Homeodomain-like
CDDcd001673.15E-93176No hitNo description
PROSITE profilePS5129425.02777131IPR017930Myb domain
SMARTSM007173.6E-1681129IPR001005SANT/Myb domain
PfamPF002495.5E-1682126IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2383129IPR009057Homeodomain-like
CDDcd001679.23E-1284126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MKTKQASKAK AAPSPGKEEE AVAPGGFRKG PWTEQEDMKL AWFVRLFGER RWDFLAKVSG  60
LNRTGKSCRL RWVNYLHPDL KRGRMSPEEE RLVVDLHARW GNRWSRIAKA MPGRTDNEIK  120
NYWRTHTRKL HKDTRAASAA SASTTTTTST SMSAASPATT SSSSSSSTND NDNHSHHGHG  180
DQETAASQEQ ADHQLLYTSG IGMDSHLLWN DALMDSYAWG AAAPSMIVPP PSSPVWDYCC  240
SDSLWGIGDD EVEYKKMLAV AGAP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-27291294103MYB PROTO-ONCOGENE PROTEIN
1h88_C4e-262912958157MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-262912958157MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-26291294103C-Myb DNA-Binding Domain
1msf_C1e-26291294103C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1836170.0JX183617.1 Triticum aestivum MYB protein (MYB56) mRNA, MYB56-B allele, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232888.12e-88PREDICTED: transcription factor MYB59-like
SwissprotQ4JL764e-64MYBA2_ORYSJ; Myb-related protein MYBAS2
TrEMBLI6U7F10.0I6U7F1_WHEAT; MYB protein
STRINGBRADI2G62510.17e-88(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.34e-60myb domain protein 59
Publications ? help Back to Top
  1. Zhang L, et al.
    Overexpression of a wheat MYB transcription factor gene, TaMYB56-B, enhances tolerances to freezing and salt stresses in transgenic Arabidopsis.
    Gene, 2012. 505(1): p. 100-7
    [PMID:22634104]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]